Invitrogen™ Human ZC3HAV1L (aa 207-296) Control Fragment Recombinant Protein

Product Code. 30212351

Brand: Invitrogen™ RP92760

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54192 (PA5-54192. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZC3HAV1L is a protein coding gene. Gene ontology (GO) annotation include cytosol.

Specifications

• Accession Number: Q96H79
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92092
• Name: Human ZC3HAV1L (aa 207-296) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C7orf39; ZC3HAV1L; Zinc finger CCCH-type antiviral protein 1-like; zinc finger CCCH-type containing, antiviral 1 like; zinc finger CCCH-type, antiviral 1-like
• Common Name: ZC3HAV1L
• Gene Symbol: ZC3HAV1L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CKRSHQLIHAASLKLLQDQGLNIPSVVNFQIISTYKHMKLHKMLENTDNSSPSTEHSQGLEKQGVHAAGAAEAGPLASVPAQSAKKPCPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining