Invitrogen™ Human ZC3H7A (aa 55-138) Control Fragment Recombinant Protein

Product Code. 30194323

Brand: Invitrogen™ RP106970

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66285 (PA5-66285. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZC3H7A contains 1 C2H2-type zinc finger, 3 C3H1-type zinc fingers and 3 TPR repeats. The function of ZC3H7A remains unknown.

Specifications

• Accession Number: Q8IWR0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29066
• Name: Human ZC3H7A (aa 55-138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A430104C18Rik; AI447294; AW556219; FLJ20318; HSPC055; ZC3H7; ZC3H7A; ZC3HDC7; Zinc finger CCCH domain-containing protein 7 A; Zinc finger CCCH domain-containing protein 7 A-like protein; zinc finger CCCH type containing 7 A; zinc finger CCCH type domain containing 7; zinc finger CCCH-type containing 7 A; zinc finger CCCH-type domain containing 7; zinc-finger protein AY163807
• Common Name: ZC3H7A
• Gene Symbol: ZC3H7A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REHDWNNSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining