Invitrogen™ Human ZC3H4 (aa 145-221) Control Fragment Recombinant Protein

Product Code. 30182593

Brand: Invitrogen™ RP99062

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59414 (PA5-59414. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a family of CCCH (C-x8-C-x5-C-x3-H type) zinc finger domain-containing proteins. These zinc finger domains, which coordinate zinc finger binding and are characterized by three cysteine residues and one histidine residue, are nucleic acid-binding. Other family members are known to function in post-transcriptional regulation.

Specifications

• Accession Number: Q9UPT8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23211
• Name: Human ZC3H4 (aa 145-221) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Bwq1; C19orf7; Gm768; KIAA1064; Kiaa1064-hp; mKIAA1064; ZC3H4; Zinc finger CCCH domain-containing protein 4; zinc finger CCCH-type containing 4
• Common Name: ZC3H4
• Gene Symbol: ZC3H4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSPSEKGHRKYREYSPPYAPSHQQYPPSHATPLPKKAYSKMDSKSYGMYEDYENEQYGEYEGDEEEDMGKEDYDDFT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining