Invitrogen™ Human ZC3H12A (aa 312-407) Control Fragment Recombinant Protein

Product Code. 30201126

Brand: Invitrogen™ RP102612

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83216 (PA5-83216. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZC3H12A is an MCP1 -induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.

Specifications

• Accession Number: Q5D1E8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80149
• Name: Human ZC3H12A (aa 312-407) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC036563; bifunctional endoribonuclease and deubiquitinase ZC3H12A; dJ423B22.1; Endoribonuclease ZC3H12A; MCP-1 treatment-induced protein; MCP-induced protein 1; MCPIP; MCPIP1; Monocyte chemotactic protein-induced protein 1; Reg1; Regnase-1; RGD:1306776}; RGD1306776; ribonuclease ZC3H12A; RP3-423B22.1; zc3h12a; zc3h12a {ECO:0000312; Zinc finger CCCH domain-containing protein 12 A; zinc finger CCCH type containing 12 A; zinc finger CCCH-type containing 12 A
• Common Name: ZC3H12A
• Gene Symbol: ZC3H12A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining