Invitrogen™ Human ZC3H10 (aa 77-165) Control Fragment Recombinant Protein

Product Code. 30180694

Brand: Invitrogen™ RP97751

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58707 (PA5-58707. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specific regulator of miRNA biogenesis. Binds, via the C3H1-type zinc finger domains, to the binding motif 5'-GCAGCGC-3' on microRNA pri-MIR143 and negatively regulates the processing to mature microRNA.

Specifications

• Accession Number: Q96K80
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84872
• Name: Human ZC3H10 (aa 77-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI790326; hypothetical protein zgc:77248; RPL41; SI:zC239J9.3; ZC3H10; ZC3HDC10; zgc:77248; Zinc finger CCCH domain-containing protein 10; zinc finger CCCH type containing 10; zinc finger CCCH-type containing 10; zinc finger CCCH-type domain containing 10
• Common Name: ZC3H10
• Gene Symbol: ZC3H10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining