Invitrogen™ Human ZBTB8B (aa 267-337) Control Fragment Recombinant Protein

Product Code. 30207041

Brand: Invitrogen™ RP109745

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145004 (PA5-145004. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZBTB8B may be involved in transcriptional regulation.

Specifications

• Accession Number: Q8NAP8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 728116
• Name: Human ZBTB8B (aa 267-337) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV220464; BC023839; BOZF1; putative zinc finger and BTB domain-containing protein 8 B; RGD1562327; Zbtb8; ZBTB8B; Zbtb8l; zinc finger and BTB domain containing 8; zinc finger and BTB domain containing 8 B; zinc finger and BTB domain-containing protein 8 B; ZNF916B
• Common Name: ZBTB8B
• Gene Symbol: ZBTB8B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining