Invitrogen™ Human ZBTB5 (aa 320-427) Control Fragment Recombinant Protein

Product Code. 30195118

Brand: Invitrogen™ RP93042

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54437 (PA5-54437. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ZBTB family of proteins is comprised of diverse zinc finger proteins that also contain a BTB (BR-C, ttk and bab) domain. ZBTB5 was identified though sequence analysis as a POZ domain Kruppel-like zinc finger (POK) protein. Further experiments indicated that it binds DNA and can directly repress transcription of the cell cycle arrest gene p21. ZBTB5 can also interact with co-repressor histone deacetylase complexes such as BCoR, NCoR, and SMRT via its POZ domain, resulting in deacetylation of histones Ac-H3 and Ac-H4 at the proximal promoter. ZBTB5 stimulates both cell proliferation and cell cycle progression, suggesting that it may act as a potential proto-oncogene.

Specifications

• Accession Number: O15062
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9925
• Name: Human ZBTB5 (aa 320-427) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5930421I10; 9430083K24Rik; AI646847; expressed in brain and neural tube; Kiaa0354; mKIAA0354; RP11-397D12.5; Transcription factor ZNF-POZ; ZBTB5; zinc finger and BTB domain containing 5; zinc finger and BTB domain-containing protein 5
• Common Name: ZBTB5
• Gene Symbol: ZBTB5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining