Invitrogen™ Human ZBTB45 (aa 362-437) Control Fragment Recombinant Protein

Product Code. 30201351

Brand: Invitrogen™ RP93593

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57387 (PA5-57387. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF499 may be involved in transcriptional regulation. In the central nervous system, it may play a role in glial cell differentiation.

Specifications

• Accession Number: Q96K62
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84878
• Name: Human ZBTB45 (aa 362-437) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BB161562; Gm157; ZBTB45; Zfp499; zinc finger and BTB domain containing 45; zinc finger and BTB domain-containing protein 45; Zinc finger protein 499; ZNF499
• Common Name: ZBTB45
• Gene Symbol: ZBTB45
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTLQPEAAPSTQLGEVPAPSAAPTTAPSGTPARTPGAEPPTYECSHCRKTFSSRKNYTKHMFIHSGEKPHQCAVCW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining