Invitrogen™ Human ZBTB20 (aa 389-538) Control Fragment Recombinant Protein

Product Code. 30196314

Brand: Invitrogen™ RP91673

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53496 (PA5-53496. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene, which was initially designated as dendritic cell-derived BTB/POZ zinc finger (DPZF), belongs to a family of transcription factors with an N-terminal BTB/POZ domain and a C-terminal DNA-bindng zinc finger domain. The BTB/POZ domain is a hydrophobic region of approximately 120 aa which mediates association with other BTB/POZ domain-containing proteins. This gene acts as a transcriptional repressor and plays a role in many processes including neurogenesis, glucose homeostasis, and postnatal growth. Mutations in this gene have been associated with Primrose syndrome as well as the 3q13.31 microdeletion syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2017]

Specifications

• Accession Number: Q9HC78
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26137
• Name: Human ZBTB20 (aa 389-538) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300017A20Rik; 7330412A13Rik; A930017C21Rik; BTB/POZ domain zinc finger factor HOF; BTB/POZ zinc finger protein DPZF; D16Wsu73e; dendritic cell-derived BTB/POZ zinc finger; Dendritic-derived BTB/POZ zinc finger protein; DPZF; HOF; Oda8; ODA-8 S; POZ/zinc finger transcription factor ODA-8; PRIMS; RGD1560387; Zbtb20; Zfp288; zinc finger and BTB domain containing 20; zinc finger and BTB domain-containing protein 20; Zinc finger protein 288; ZNF288
• Common Name: ZBTB20
• Gene Symbol: ZBTB20
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining