Invitrogen™ Human ZBTB14 (aa 81-173) Control Fragment Recombinant Protein

Product Code. 30209237

Brand: Invitrogen™ RP91702

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62236 (PA5-62236. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional activator of the dopamine transporter (DAT), binding it's promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. Binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene. Transcriptional repressor of MYC and thymidine kinase promoters.

Specifications

• Accession Number: O43829
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7541
• Name: Human ZBTB14 (aa 81-173) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: b2b1982Clo; Zbtb14; ZF5; ZFP161; zfp-161; ZFP161 zinc finger protein; Zfp5; Zfp-5; zinc finger and BTB domain containing 14; zinc finger and BTB domain-containing protein 14; Zinc finger protein 161; zinc finger protein 161 homolog; Zinc finger protein 478; zinc finger protein 5; Zinc finger protein 5 homolog; zinc finger protein homologous to Zfp161 in mouse; ZNF478
• Common Name: ZBTB14
• Gene Symbol: ZBTB14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining