Invitrogen™ Human ZBED5 (aa 155-251) Control Fragment Recombinant Protein

Product Code. 30209539

Brand: Invitrogen™ RP100576

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61747 (PA5-61747. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is unusual in that its coding sequence is mostly derived from Charlie-like DNA transposon; however, it does not appear to be an active DNA transposon as it is not flanked by terminal inverted repeats. The encoded protein is conserved among the mammalian Laurasiatheria branch. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Specifications

• Accession Number: Q49AG3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 58486
• Name: Human ZBED5 (aa 155-251) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Buster1; Transposon-derived Buster1 transposase-like protein; ZBED5; Zinc finger BED domain-containing protein 5; zinc finger BED-type containing 5; zinc finger, BED-type containing 5
• Common Name: ZBED5
• Gene Symbol: ZBED5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining