Invitrogen™ Human Zap-70 (aa 246-385) Control Fragment Recombinant Protein

Product Code. 30195932

Brand: Invitrogen™ RP95380

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82063 (PA5-82063. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZAP-70 is a cytosolic protein tyrosine kinase that is a member of the Syk family of proteins. ZAP-70 is expressed exclusively in T-cells and natural killer cells and is required for T-cell receptor activation. Upon T cell antigen receptor (TCR) engagement, ZAP70 is phosphorylated on tyrosines 292, 315 and 319 in the interdomain B, located between the SH2 and kinase domains. Phosphorylation of both tyrosines 315 (a Vav binding site) and 319 (a Lck binding site) enhances ZAP70 function in mediating lymphocyte signaling, while tyrosine 292 terminates the transient activation of ZAP70 and attentuates lymphocyte signaling.

Specifications

• Accession Number: P43403
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7535
• Name: Human Zap-70 (aa 246-385) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 70 kDa zeta-associated protein; 70 kDa zeta-chain associated protein; ADMIO2; EC 2.7.10.2; FLJ17670; FLJ17679; I79_004087; IMD48; kinase ZAP70; mrtle; mur; Selective T cell defect; Srk; STCD; STD; syk-related protein tyrosine kinase; syk-related tyrosine kinase; Tyrosine-protein kinase ZAP-70; Tyrosine-protein kinase ZAP-70;TZK; TZK; ZA70; Zap70; ZAP-70; Zeta chain associated protein kinase 70 kDa; zeta chain of T cell receptor associated protein kinase; zeta chain of T cell receptor associated protein kinase 70; zeta chain of T cell receptor associated protein kinase 70 kDa; zeta-chain (TCR) associated protein kinase; zeta-chain (TCR) associated protein kinase 70; zeta-chain (TCR) associated protein kinase 70 kDa; zeta-chain associated protein kinase 70 kDa; zeta-chain associated protein kinase, 70 kD
• Common Name: Zap-70
• Gene Symbol: ZAP70
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining