missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211904

Invitrogen™ Human ZADH2 (aa 146-248) Control Fragment Recombinant Protein

Product Code. 30211904
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211904

Brand: Invitrogen™ RP106481

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65808 (PA5-65808. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZADH2 (zinc binding alcohol dehydrogenase domain containing 2) is a 377 amino acid protein that belongs to the zinc-containing alcohol dehydrogenase family and is encoded by a gene which maps to human chromosome 18. Chromosome 18 houses over 300 protein-coding genes and contains nearly 76 million bases. There are a variety of diseases associated with defects in chromosome 18-localized genes, some of which include Trisomy 18 (also known as Edwards syndrome), Niemann-Pick disease, hereditary hemorrhagic telangiectasia, erythropoietic protoporphyria and follicular lymphomas.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N4Q0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 284273
Name Human ZADH2 (aa 146-248) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 15-oxoprostaglandin 13-reductase; C530046K17Rik; PRG-3; Prostaglandin reductase 3; Prostaglandin reductase-3; PTGR3; PTGR-3; Pthr3; Zadh2; zinc binding alcohol dehydrogenase domain containing 2; zinc binding alcohol dehydrogenase, domain containing 2; zinc-binding alcohol dehydrogenase domain-containing protein 2
Common Name ZADH2
Gene Symbol Zadh2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.