Invitrogen™ Human YTHDF2 (aa 326-396) Control Fragment Recombinant Protein

Product Code. 30202557

Brand: Invitrogen™ RP108331

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. Acts as a regulator of mRNA stability: binding to m6A-containing mRNAs results in the localization to mRNA decay sites, such as processing bodies (P-bodies), leading to mRNA degradation. Also acts as a promoter of cap-independent mRNA translation following heat shock stress: upon stress, relocalizes to the nucleus and specifically binds mRNAs with some m6A methylation mark at their 5'-UTR, protecting demethylation of mRNAs by FTO, thereby promoting cap-independent mRNA translation.

Specifications

• Accession Number: Q9Y5A9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51441
• Name: Human YTHDF2 (aa 326-396) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9430020E02Rik; CAHL; CLL-associated antigen KW-14; HGRG8; high glucose-regulated protein 8; high-glucose-regulated protein 8; LOW QUALITY PROTEIN: YTH domain-containing family protein 2; NY-REN-2; renal carcinoma antigen NY-REN-2; YTH domain family 2; YTH domain family protein 2; YTH domain family, member 2; YTH domain-containing family protein 2; YTH N(6)-methyladenosine RNA binding protein 2; YTH N6-methyladenosine RNA binding protein 2; yth2; YTHDF2; zgc:56224
• Common Name: YTHDF2
• Gene Symbol: YTHDF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSIN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining