Invitrogen™ Human YTHDC1 (aa 69-160) Control Fragment Recombinant Protein

Product Code. 30202788

Brand: Invitrogen™ RP96608

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57670 (PA5-57670. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be part of a signal transduction pathway that influences splice site selection. Target protein binds nuclear transcriptosomal complex scaffold attachment factor B (SAF-B) and Sam68; may play a role in splice site selection and alternative splicing.

Specifications

• Accession Number: Q96MU7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91746
• Name: Human YTHDC1 (aa 69-160) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A730098D12Rik; C80342; KIAA1966; mKIAA1966; putative splicing factor YT521; RA301-binding protein; Splicing factor YT521; splicing factor YT521-B; YT521; YT521-B; YTH domain containing 1; YTH domain-containing protein 1; YTHDC1
• Common Name: YTHDC1
• Gene Symbol: YTHDC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining