missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human YTHDC1 (aa 69-160) Control Fragment Recombinant Protein

Product Code. 30202788
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30202788 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30202788 Supplier Invitrogen™ Supplier No. RP96608

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57670 (PA5-57670. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be part of a signal transduction pathway that influences splice site selection. Target protein binds nuclear transcriptosomal complex scaffold attachment factor B (SAF-B) and Sam68; may play a role in splice site selection and alternative splicing.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96MU7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91746
Name Human YTHDC1 (aa 69-160) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A730098D12Rik; C80342; KIAA1966; mKIAA1966; putative splicing factor YT521; RA301-binding protein; Splicing factor YT521; splicing factor YT521-B; YT521; YT521-B; YTH domain containing 1; YTH domain-containing protein 1; YTHDC1
Common Name YTHDC1
Gene Symbol YTHDC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.