missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210234

Invitrogen™ Human YOD1 (aa 116-191) Control Fragment Recombinant Protein

Product Code. 30210234
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210234

Brand: Invitrogen™ RP94482

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55837 (PA5-55837. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Deubiquitinating enzymes (DUBs) are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA8 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5VVQ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55432
Name Human YOD1 (aa 116-191) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9930028C20Rik; DUBA8; DUBA-8; fe01a10; HIN7; HIN-7; HIV-1-induced protease 7; HIV-induced protein-7-like protease; hsHIN7; hypothetical protein LOC550411; OTU domain containing 2; OTU domain-containing protein 2; OTUD2; PRO0907; Ubiquitin thioesterase OTU1; wu:fe01a10; Yod1; YOD1 deubiquitinase; YOD1 OTU deubiquinating enzyme 1 homolog; YOD1 OTU deubiquinating enzyme 1 homolog (yeast); YOD1 OTU deubiquitinating enzyme 1 homologue; YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae); zgc:112182
Common Name YOD1
Gene Symbol YOD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.