Invitrogen™ Human YKT6 (aa 65-131) Control Fragment Recombinant Protein

Product Code. 30196273

Brand: Invitrogen™ RP95596

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56565 (PA5-56565. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product is one of the SNARE recognition molecules implicated in vesicular transport between secretory compartments. It is a membrane associated, isoprenylated protein that functions at the endoplasmic reticulum-Golgi transport step. This protein is highly conserved from yeast to human and can functionally complement the loss of the yeast homolog in the yeast secretory pathway.

Specifications

• Accession Number: O15498
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10652
• Name: Human YKT6 (aa 65-131) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610042I15Rik; 1810013M05Rik; AW105923; prenylated SNARE protein; prenylated SNARE protein (Ykt6); R-SNARE; SNARE protein Ykt6; synaptobrevin homolog YKT6; Ykt6; YKT6 homolog; YKT6 homolog (S. Cerevisiae); YKT6 v-SNARE homolog (S. cerevisiae); YKT6 v-SNARE protein; YKT6, S. cerevisiae, homolog of
• Common Name: YKT6
• Gene Symbol: YKT6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining