Invitrogen™ Human YIPF7 (aa 131-168) Control Fragment Recombinant Protein

Product Code. 30211810

Brand: Invitrogen™ RP102348

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56528 (PA5-56528. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

YIPF7 is a protein coding gene.

Specifications

• Accession Number: Q8N8F6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 285525
• Name: Human YIPF7 (aa 131-168) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FinGER9; Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9; protein YIPF7; RGD1310766; Yip1 domain family member 7; Yip1 domain family, member 7; YIP1 family member 7; YIP1B; YIPF7
• Common Name: YIPF7
• Gene Symbol: YIPF7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTVLNPMKPVDGSIMNETDLTGPILFCVALGATLLLAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining