Invitrogen™ Human YBX2 (aa 66-100) Control Fragment Recombinant Protein

Product Code. 30212531

Brand: Invitrogen™ RP101090

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111440 (PA5-111440. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

YBX2 is a germ-cell specific member of the vertebrate Y box family of nucleic acid-binding proteins.

Specifications

• Accession Number: Q9Y2T7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51087
• Name: Human YBX2 (aa 66-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Contrin; CSDA3; Dbpc; DNA-binding protein C; FRGY2 homolog; germ cell specific Y-box binding protein; germ cell-specific Y-box-binding protein; MSY2; MSY2 homolog; RGD1305068; Y box binding protein 2; Y box protein 2; Y-box binding protein 2; Y-box protein MSY2; Y-box-binding protein 2; Ybx2
• Common Name: YBX2
• Gene Symbol: YBX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining