Invitrogen™ Human YARS (aa 126-243) Control Fragment Recombinant Protein

Product Code. 30209728

Brand: Invitrogen™ RP92042

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110831 (PA5-110831. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.

Specifications

• Accession Number: P54577
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8565
• Name: Human YARS (aa 126-243) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL024047; AU018965; CMTDIC; tyrosine tRNA ligase 1, cytoplasmic; tyrosine--tRNA ligase, cytoplasmic; Tyrosine--tRNA ligase, cytoplasmic, N-terminally processed; tyrosyl trna synthetase; tyrosyl--tRNA ligase; tyrosyl-tRNA synthetase; tyrosyl-tRNA synthetase, cytoplasmic; tyrRS; Yars; YRS; YTS
• Common Name: YARS
• Gene Symbol: YARS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining