missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202246

Invitrogen™ Human XTP4 (aa 61-110) Control Fragment Recombinant Protein

Product Code. 30202246
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202246

Brand: Invitrogen™ RP101790

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

During the past decade, the role of the ERBB2(neu/HER2) oncogene as an important predictor of patient outcome and response to various therapies in breast cancer has been clearly established. The C35 (C17orf37) is a novel tumor biomarker abundantly expressed in breast cancer. Identification of shared tumor-specific targets is useful in developing broadly applicable therapies. The C35 gene is located on chromosome 17q12, 505nucleotides from the 3' end of the ERBB2oncogene, the antigenic target for trastuzumab(Herceptin) therapy. The chromosomal arrangement of the genes encoding C35 andERBB2 is tail to tail. The ORF 37 open reading frame encodes a 12-kDa protein of unknown function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BRT3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84299
Name Human XTP4 (aa 61-110) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810046J19Rik; AI463380; C16H17orf37; C17orf37; C35; HBV XAg-transactivated protein 4; HBV X-transactivated gene 4 protein; MGC14832; MIEN1; Migration and invasion enhancer 1; ORB3; protein C17orf37; protein C17orf37 homolog; Protein C35; RD x 12; RGD1306682; XTP4
Common Name XTP4
Gene Symbol MIEN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.