Invitrogen™ Human XRCC6BP1 (aa 88-167) Control Fragment Recombinant Protein

Product Code. 30193757

Brand: Invitrogen™ RP95848

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57403 (PA5-57403. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is amplified in glioblastomas and interacts with the DNA binding subunit of DNA-dependent protein kinase. This kinase is involved in double-strand break repair (DSB), and higher expression of the encoded protein increases the efficiency of DSB. In addition, comparison to orthologous proteins strongly suggests that this protein is a metalloprotease important in the biosynthesis of mitochondrial ATPase. Several transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9Y6H3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91419
• Name: Human XRCC6BP1 (aa 88-167) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110068E08Rik; 2410012H02Rik; atp23; ATP23 metallopeptidase and ATP synthase assembly factor homolog; Ku70 binding protein 3; Ku70-binding protein 3; KUB3; LOW QUALITY PROTEIN: mitochondrial inner membrane protease ATP23 homolog; mitochondrial inner membrane protease ATP23 homolog; XRCC6 binding protein 1; XRCC6-binding protein 1; Xrcc6bp1; zgc:162885
• Common Name: XRCC6BP1
• Gene Symbol: ATP23
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining