missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human XRCC1 (aa 125-257) Control Fragment Recombinant Protein

Product Code. 30196398
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196398

Brand: Invitrogen™ RP89468

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82259 (PA5-82259. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

XRCC1 (X-ray cross complementing factor-1) is involved in DNA base excision repair. XRCC1 is a 70 kDa protein that has been shown to be physically associated with other DNA repair enzymes, including poly (ADP-ribose) polymerase (PARP), DNA Ligase III and DNA polymerase beta. XRCC1 contains a BRCT domain (for BRCA1 carboxyl terminus) which was originally found in the tumor suppressor protein BRCA1. Recently, the BRCT domain has been shown to mediate the protein-protein interaction of XRCC1 and DNA ligase III-alpha.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P18887
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7515
Name Human XRCC1 (aa 125-257) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DNA repair protein XRCC1; RCC; X-ray repair complementing defective repair in Chinese hamster cells 1; X-ray repair cross complementing 1; x-ray repair cross-complementing group 1 protein; X-ray repair cross-complementing protein 1; XRCC1; Xrcc-1
Common Name XRCC1
Gene Symbol XRCC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.