Invitrogen™ Human XPR1 (aa 604-696) Control Fragment Recombinant Protein

Product Code. 30198798

Brand: Invitrogen™ RP103718

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82552 (PA5-82552. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Xenotropic and polytropic retrovirus receptor (XPR1) is an Orphan-U GPCR with an unknown ligand. ESTs have been isolated from brain, breast, kidney, pancreas, placenta, prostate, skeletal muscle, testis, and tonsil libraries.

Specifications

• Accession Number: Q9UBH6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9213
• Name: Human XPR1 (aa 604-696) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: IBGC6; Protein SYG1 homolog; receptor for MCF virus 1; Rmc1; Rmc-1; RP11-46A10.1; susceptibility to xenotropic virus; Sxv; Syg1; X3; xenotropic and polytropic murine leukemia virus receptor; xenotropic and polytropic murine leukemia virus receptor X3; Xenotropic and polytropic retrovirus receptor 1; xenotropic and polytropic retrovirus receptor 1 homolog; XPR1; XR; X-receptor
• Common Name: XPR1
• Gene Symbol: Xpr1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining