Invitrogen™ Human XPO5 (aa 1091-1171) Control Fragment Recombinant Protein

Product Code. 30198118

Brand: Invitrogen™ RP91844

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54941 (PA5-54941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Exportin-5 belongs to a large family of karyopherins that mediate the transport of proteins and other cargo between the nuclear and cytoplasmic compartments. Exportin-5 belongs to a large family of karyopherins that mediate the transport of proteins and other cargo between the nuclear and cytoplasmic compartments.

Specifications

• Accession Number: Q9HAV4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57510
• Name: Human XPO5 (aa 1091-1171) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410004H11Rik; 2700038C24Rik; AI648907; AW549301; exp5; exportin 5; exportin-5; FLJ14239; FLJ32057; FLJ45606; KIAA1291; mKIAA1291; Ran-binding protein 21; RanBp21; Xpo5
• Common Name: XPO5
• Gene Symbol: XPO5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGEQFRKEVH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining