Invitrogen™ Human XPG Control Fragment Recombinant Protein

Product Code. 30210128

Brand: Invitrogen™ RP95291

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62177 (PA5-62177. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Xeroderma pigmentosum type G (XPG) is a human genetic disease exhibiting extreme sensitivity to sunlight. The XPG protein, a member of the flap endonuclease 1 (FEN-1) structure-specific DNA repair endonuclease family, is an enzyme essential for DNA repair of the major kinds of solar ultraviolet (UV)-induced DNA damages. Human XPG nuclease makes the 3' incision during nucleotide excision repair of DNA. The enzyme cleaves model DNA bubble structures specifically near the junction of unpaired DNA with a duplex region. A 29-amino acid region of human XPG (residues 981-1009) contains the PCNA binding activity. A conserved arginine in XPG (Arg992) is crucial for its PCNA binding activity. Replication Protein A (RPA) binds specifically and directly to two excision repair proteins, the xeroderma pigmentosum damage-recognition protein XPA and the endonuclease XPG.

Specifications

• Accession Number: P28715
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2073
• Name: Human XPG Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: COFS 3; COFS3; DNA excision repair protein ERCC-5; DNA repair protein complementing XP-G cells; DNA repair protein complementing XP-G cells homolog; ERCC 5; ERCC excision repair 5, endonuclease; ERCC5; ERCC5-201; ERCM 2; ERCM2; excision repair cross-complementation group 5; excision repair cross-complementing rodent repair deficiency, complementation group 5; OTTHUMP00000064902; RP11-484I6.5; UVDR; Xe; xeroderma pigmentosum; Xeroderma pigmentosum group G-complementing protein; xeroderma pigmentosum group G-complementing protein homolog; xeroderma pigmentosum, complementation group G; XPG; XPGC; XPG-complementing protein
• Common Name: XPG
• Gene Symbol: ERCC5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining