Invitrogen™ Human XKR8 (aa 342-395) Control Fragment Recombinant Protein

Product Code. 30180465

Brand: Invitrogen™ RP99820

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62115 (PA5-62115. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Promotes phosphatidylserine exposure on apoptotic cell surface, possibly by mediating phospholipid scrambling. Phosphatidylserine is a specific marker only present at the surface of apoptotic cells and acts as a specific signal for engulfment. Has no effect on calcium-induced exposure of phosphatidylserine. Activated upon caspase cleavage, suggesting that it does not act prior the onset of apoptosis.

Specifications

• Accession Number: Q9H6D3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55113
• Name: Human XKR8 (aa 342-395) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: hXkr8; RP11-460I13.3; x Kell blood group precursor-related family, member 8; XK related 8; XK, Kell blood group complex subunit-related family, member 8; XKR8; XK-related protein 8; XK-related protein 8, processed form; X-linked Kx blood group related 8; XRG8
• Common Name: XKR8
• Gene Symbol: XKR8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HPSCCWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining