missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205457

Invitrogen™ Human XKR6 (aa 495-591) Control Fragment Recombinant Protein

Product Code. 30205457
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205457

Brand: Invitrogen™ RP93900

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55198 (PA5-55198. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

XK is a 444 amino acid protein that spans the membrane 10 times and carries the ubiquitous antigen, Kx, which determines blood type. The XK (X-linked Kx blood group)-related gene family are homologs of XK. XKR6 (XK-related protein 6) is a 641 amino acid multi-pass membrane protein that likely is a component of the XK/Kell complex of the Kell blood group system. The gene encoding XKR6 maps to human chromosome 8, which is made up of nearly 146 million bases and encodes about 800 genes. There are two isoforms of XKR6 that are produced as a result of alternative splicing events.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5GH73
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 286046
Name Human XKR6 (aa 495-591) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC024502; C8orf21; C8orf5; C8orf7; LOW QUALITY PROTEIN: XK-related protein 6; RGD1310719; Transmembrane protein C8orf5; x Kell blood group precursor related family member 6 homolog; x Kell blood group precursor-related family, member 6; XK related 6; XK, Kell blood group complex subunit-related family, member 6; XKR6; XK-related protein 6; X-linked Kx blood group related 6; Xrg6
Common Name XKR6
Gene Symbol XKR6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.