Invitrogen™ Human XDH (aa 631-722) Control Fragment Recombinant Protein

Product Code. 30206498

Brand: Invitrogen™ RP107180

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66510 (PA5-66510. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

XDH belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The enzyme is a homodimer. This protein can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism.

Specifications

• Accession Number: P47989
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7498
• Name: Human XDH (aa 631-722) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Unknown (protein for MGC:127098); xanthine dehydrogenase; Xanthine dehydrogenase/oxidase; xanthine oxidase; Xanthine oxidoreductase; XD; Xdh; xdh antibody; XDHA; xdha antibody; XO; XOR; xor antibody; Xox1; Xox-1
• Common Name: XDH
• Gene Symbol: XDH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining