Invitrogen™ Human WWOX (aa 32-110) Control Fragment Recombinant Protein

Product Code. 30181603

Brand: Invitrogen™ RP99959

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a short-chain dehydrogenase/reductase domain (SRD). The highest normal expression of this gene is detected in hormonally regulated tissues such as testis, ovary, and prostate. This expression pattern and the presence of an SRD domain suggest a role for this gene in steroid metabolism. The encoded protein is more than 90% identical to the mouse protein, which is an essential mediator of tumor necrosis factor-alpha-induced apoptosis, suggesting a similar, important role in apoptosis for the human protein. In addition, there is evidence that this gene behaves as a suppressor of tumor growth. Alternative splicing of this gene generates transcript variants that encode different isoforms.

Specifications

• Accession Number: Q9NZC7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51741
• Name: Human WWOX (aa 32-110) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5330426P09Rik; 9030416C10Rik; D16S432E; EIEE28; FOR; FRA16D; Fragile site FRA16D oxidoreductase; HHCMA56; PRO0128; SCAR12; SDR41C1; Short chain dehydrogenase/reductase family 41 C member 1; short chain dehydrogenase/reductase family 41 C, member 1; WO x 1; WW domain containing oxidoreductase; WW domain-containing oxidoreductase; WW domain-containing protein WWOX; WW-domain oxidoreductase; Wwox
• Common Name: WWOX
• Gene Symbol: Wwox
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining