Invitrogen™ Human WWC2 (aa 784-884) Control Fragment Recombinant Protein

Product Code. 30207065

Brand: Invitrogen™ RP100156

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60582 (PA5-60582. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the WW-and-C2-domain-containing family of proteins. Members of this family have two N-terminal WW domains that mediate binding to target proteins harboring L/PPxY motifs, an internal C2 domain for membrane association, and C-terminal alpha protein kinase C binding sites and class III PDZ domain-interaction motifs. Proteins of this family are able to form homo- and heterodimers and to modulate hippo pathway signaling.

Specifications

• Accession Number: Q6AWC2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80014
• Name: Human WWC2 (aa 784-884) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5330431C14Rik; AU022508; BH-3-only member B; BH3-only member B protein; BOMB; C85457; D8Ertd594e; LOW QUALITY PROTEIN: protein WWC2; MNCb-4173; Protein WWC2; RGD1559427; WW and C2 domain containing 2; WW domain-containing protein 2; WW, C2 and coiled-coil domain containing 2; WWC2
• Common Name: WWC2
• Gene Symbol: WWC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRVDLCSVSKHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDSVFQPNQPLVDSIDLDAVSALLARTSAELLAVEQELAQEEEEESG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining