Invitrogen™ Human WTAP (aa 2-106) Control Fragment Recombinant Protein

Product Code. 30199370

Brand: Invitrogen™ RP89845

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Wilms' tumor (WT) is an embryonal malignancy of the kidney that affects 1 in 10,000 infants and is observed in both sporadic and inherited forms. The Wilms' tumor protein (WT1) binds the DNA sequence GCGGGGGCG, a recognition element common to the early growth response (Egr) family of Zn2+ finger transcriptional activators, and functions as a transcriptional repressor. WTAP (Wilms tumor 1-associating protein) is a ubiquitously expressed nuclear protein that interacts with WT1 and may be involved in regulating mRNA splicing. WTAP is found in nuclear speckles, where it regulates the G2/M cell cycle transition by binding to the 3' UTR of cyclin A2, thus enhancing its stability. Additionally, WTAP inhibits expression of WT1 target genes and is able to impair the ability of WT1 to bind DNA. Two isoforms of WTAP exist due to alternative splicing events.

Specifications

• Accession Number: Q15007
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9589
• Name: Human WTAP (aa 2-106) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810408K05Rik; 9430038B09Rik; Female-lethal(2)D homolog; hFL(2)D; KIAA0105; Mum2; PNAS-132; pre-mRNA-splicing regulator WTAP; putative pre-mRNA splicing regulator female-lethal(2 D); RGD1563824; Wilms tumor 1 associated protein; wilms tumor 1-associating protein; Wilms' tumour 1-associating protein; Wilms tumour 1-associating protein; WT1-associated protein; WTAP
• Common Name: WTAP
• Gene Symbol: WTAP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining