Invitrogen™ Human WT1 (aa 68-149) Control Fragment Recombinant Protein

Product Code. 30210116

Brand: Invitrogen™ RP106495

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111380 (PA5-111380. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Wilms Tumor 1 gene encodes one of the WPP domain-interacting proteins (Wilms Tumor 1/AT5G11390, WIT2/AT1G68910) required for RanGAP nuclear envelope association in root tip cells. Ran GTPase plays essential roles in multiple cellular processes, including nucleocytoplasmic transport, spindle formation, and postmitotic nuclear envelope reassembly. The cytoplasmic Ran GTPase activating protein RanGAP is critical to establish a functional RanGTP/RanGDP gradient across the nuclear envelope and is associated with the outer surface of the nuclear envelope in metazoan and higher plant cells. Arabidopsis thaliana RanGAP association with the root tip nuclear envelope requires a family of likely plant-specific nucleoporins combining coiled-coil and transmembrane domains (CC-TMD) and WPP domain-interacting proteins (WIPs). Wilms Tumor 1 and WIT2 have been identified as a second family of CC-TMD proteins, structurally similar, yet clearly distinct from the WIP family, that is required for RanGAP nuclear envelop association in root tip cells.

Specifications

• Accession Number: P19544
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7490
• Name: Human WT1 (aa 68-149) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AWT1; D630046I19Rik; EWS-WT1; GUD; NPHS4; WAGR; Wilms tumor 1; Wilms tumor 1 homolog; Wilms tumor protein; Wilms tumor protein homolog; Wilms tumor protein isoform E x 4 A(+); WIT1; WIT-1; WIT-2; WT; Wt1; Wt-1; WT1 antisense RNA; WT1AS; WT1-AS; WT1-AS1; WT33
• Common Name: WT1
• Gene Symbol: WT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining