Invitrogen™ Human WSCD2 (aa 61-170) Control Fragment Recombinant Protein

Product Code. 30194565

Brand: Invitrogen™ RP89984

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53046 (PA5-53046. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains known.

Especificaciones

• Accession Number: Q2TBF2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9671
• Name: Human WSCD2 (aa 61-170) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933413A10Rik; C530024P05Rik; Gm450; KIAA0789; MGC117165; si:ch211-240b21.1; WSC domain containing 2; WSC domain containing 2, pseudogene 1; WSC domain-containing protein 2; wscd2; Wscd2-ps1
• Common Name: WSCD2
• Gene Symbol: WSCD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GAELSFLGDMHLGRGFRDTGEASSIARRYGPWFKGKDGNERAKLGDYGGAWSRALKGRVVREKEEERAKYIGCYLDDTQSRALRGVSFFDYKKMTIFRCQDNCAERGYLY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining