Invitrogen™ Human WRN (aa 830-971) Control Fragment Recombinant Protein

Product Code. 30196059

Brand: Invitrogen™ RP89491

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83025 (PA5-83025. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the RecQ subfamily and the DEAH (Asp-Glu-Ala-His) subfamily of DNA and RNA helicases. DNA helicases are involved in many aspects of DNA metabolism, including transcription, replication, recombination, and repair. This protein contains a nuclear localization signal in the C-terminus and shows a predominant nucleolar localization. It possesses an intrinsic 3' to 5' DNA helicase activity, and is also a 3' to 5' exonuclease. Based on interactions between this protein and Ku70/80 heterodimer in DNA end processing, this protein may be involved in the repair of double strand DNA breaks. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by premature aging.

Specifications

• Accession Number: Q14191
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7486
• Name: Human WRN (aa 830-971) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI846146; DKFZp686C2056; DNA helicase, RecQ-like type 3; exonuclease WRN; RecQ protein-like 2; RecQ3; RECQL2; RECQL3; RGD1564788; similar to Werner syndrome helicase homolog; Werner syndrome ATP-dependent helicase; Werner syndrome ATP-dependent helicase homolog; Werner syndrome homolog (human); Werner syndrome RecQ like helicase; Werner syndrome, RecQ helicase-like; WRN
• Common Name: WRN
• Gene Symbol: WRN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KADIRQVIHYGAPKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFGPQAFKLLSAVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining