Invitrogen™ Human WRB (aa 33-101) Control Fragment Recombinant Protein

Product Code. 30197964

Brand: Invitrogen™ RP91126

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53834 (PA5-53834. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a basic nuclear protein of unknown function. The gene is widely expressed in adult and fetal tissues. Since the region proposed to contain the gene(s) for congenital heart disease (CHD) in Down syndrome (DS) patients has been restricted to 21q22.2-22.3, this gene, which maps to 21q22.3, has a potential role in the pathogenesis of Down syndrome congenital heart disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: O00258
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7485
• Name: Human WRB (aa 33-101) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5530402J05Rik; C030018G21Rik; Chd5; Congenital heart disease 5 protein; GET1; tail-anchored protein insertion receptor WRB; tryptophan rich basic protein; tryptophan-rich basic protein; tryptophan-rich protein; Wrb
• Common Name: WRB
• Gene Symbol: GET1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining