missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202347

Invitrogen™ Human WRAP53 (aa 111-230) Control Fragment Recombinant Protein

Product Code. 30202347
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202347

Brand: Invitrogen™ RP93294

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54669 (PA5-54669. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TXNDC1 is a thioredoxin -related protein with disulfide reductase activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BUR4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55135
Name Human WRAP53 (aa 111-230) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC021790; DKCB3; TCAB1; Telomerase Cajal body protein 1; WD repeat containing antisense to TP53; WD repeat containing, antisense to TP53; WD repeat containing, antisense to Trp53; WD repeat domain 79; WD repeat-containing protein 79; WD repeat-containing protein WRAP53; WD40 protein Wrap53; WD40 repeat-containing protein antisense to TP53; WD40 repeat-containing protein antisense to TP53 gene; WD40 repeat-containing protein antisense to TP53 gene homolog; WD40 repeat-containing protein encoded by RNA antisense to p53; WD40 repeat-containing protein encoding RNA antisense to p53; Wdr79; WRAP53; WRAP53beta
Common Name WRAP53
Gene Symbol WRAP53
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.