Invitrogen™ Human WNT16 Control Fragment Recombinant Protein

Product Code. 30205659

Brand: Invitrogen™ RP90625

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen. WNT15 is also a ligand for members of the frizzled family of seven transmembrane receptors.

Specifications

• Accession Number: Q9UBV4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51384
• Name: Human WNT16 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: E130309I19Rik; Protein Wnt-16; wingless-related MMTV integration site 16; wingless-type MMTV integration site family member 16; wingless-type MMTV integration site family member 16 b; wingless-type MMTV integration site family, member 16; Wnt family member 16; Wnt16
• Common Name: WNT16
• Gene Symbol: Wnt16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining