Invitrogen™ Human WNK3 (aa 582-675) Control Fragment Recombinant Protein

Product Code. 30196635

Brand: Invitrogen™ RP108120

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67465 (PA5-67465. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WNK3 is a serine/threonine kinase involved in signal transduction and cellular communication. Members of the 'with no lysine' kinase family, such as WNK3, are serine-threonine protein kinases that lack the almost invariant catalytic lysine in subdomain II, which is important for binding ATP in the catalytic site. Instead, these kinases have a conserved lysine in subdomain I that is thought to provide this function.

Specifications

• Accession Number: Q9BYP7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65267
• Name: Human WNK3 (aa 582-675) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KIAA1566; PRKWNK 3; PRKWNK3; Protein kinase lysine-deficient 3; protein kinase with no lysine 3; RGD1563131; serine/threonine-protein kinase WNK3; WNK 3; WNK lysine deficient protein kinase 3; WNK lysine deficient protein kinase 3, pseudogene; WNK3; Wnk3-ps
• Common Name: WNK3
• Gene Symbol: WNK3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining