Invitrogen™ Human WNK2 (aa 1676-1803) Control Fragment Recombinant Protein

Product Code. 30201536

missing translation for 'mfr': Invitrogen™ RP91472

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53440 (PA5-53440. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WNK2 is a serine/threonine kinase involved in signal transduction and cellular communication. WNK kinases contain a lysine upstream of the traditional position, within a glycine string. This lysine functions as an anchor and orients ATP through interactions with the alpha and beta phosphoryl groups. The catalytic domains of WNK2, WNK3 and WNK4 are 95% homologous to WNK1. The human WNK1 gene encodes a 2,382 amino acid protein that is primarily expressed in heart, kidney, muscle and distal nephron. The human WNK3 gene encodes a protein that is primarily expressed in brain; the human WNK4 gene encodes a 1,243 amino acid protein that is expressed in kidney. Aberrant function of WNK kinases and their associated signaling pathways are implicated in hypertension, increased renal salt reabsorption and impaired K+ and H+ excretion.

Specifications

• Accession Number: Q9Y3S1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65268
• Name: Human WNK2 (aa 1676-1803) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810073P09Rik; Antigen NY-CO-43; AW122246; ESTM15; Kiaa1760; kinase deficient protein; LOW QUALITY PROTEIN: serine/threonine-protein kinase WNK2; mitogen-activated protein kinase kinase kinase; mKIAA1760; NY-CO-43; P/OKcl0.13; PRKWNK2; protein kinase lysine-deficient 2; Protein kinase with no lysine 2; protein kinase, lysine deficient 2; RGD1307284; SDCCAG43; Serine/threonine-protein kinase WNK2; serologically defined colon cancer antigen 43; WNK lysine deficient protein kinase 2; Wnk2; X83337
• Common Name: WNK2
• Gene Symbol: WNK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTSSSMTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining