Invitrogen™ Human WISP3 (aa 23-65) Control Fragment Recombinant Protein

Product Code. 30209684

Brand: Invitrogen™ RP107316

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85059 (PA5-85059. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WISP3 is a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like domain. WISP3 is overexpressed in colon tumors. It may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Mutations of the WISP3 gene are associated with progressive pseudorheumatoid dysplasia, an autosomal recessive skeletal disorder, indicating that the gene is essential for normal postnatal skeletal growth and cartilage homeostasis.

Specifications

• Accession Number: O95389
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8838
• Name: Human WISP3 (aa 23-65) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CCN family member 6; CCN6; Cellular communication network factor 6; ENSMUSG00000062074; Gm735; LIBC; PPAC; PPD; RGD1564120; UNQ462/PRO790/PRO956; Wisp3; WISP-3; WNT1 inducible signaling pathway protein 3; WNT1-inducible-signaling pathway protein 3
• Common Name: WISP3
• Gene Symbol: CCN6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining