missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202833

Invitrogen™ Human WIPI1 (aa 299-437) Control Fragment Recombinant Protein

Product Code. 30202833
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202833

Brand: Invitrogen™ RP89638

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52443 (PA5-52443. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WIPI1 (WD repeat domain, phosphoinositide interacting-1), also known as WIPI1, ATG18 or WIPI49, is thought to play a role in autophagy and may regulate protein trafficking in certain recycling pathways. It contains three WD repeats and has a 7-bladed propeller structure with a conserved motif that facilitates its interaction with other proteins. WIPI1 localizes to cytoplasmic vesicles, endosomes, clathrin-coated vesicles and the trans-Golgi network. It is ubiquitously expressed with highest expression in heart, testis, placenta, pancreas and skeletal muscle. WIPI1 is upregulated in a variety of tumors, suggesting a role in carcinogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5MNZ9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55062
Name Human WIPI1 (aa 299-437) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930533H01Rik; ATG18; Atg18 protein homolog; ATG18A; AW411817; D11Ertd498e; RGD1307754; WD repeat domain phosphoinositide-interacting protein 1; WD repeat domain, phosphoinositide interacting 1; WD40 repeat protein interacting with phosphoinositides of 49 kDa; WD40 repeat protein Interacting with phosphoInositides of 49 kDa; WIPI 49 kDa; Wipi1; WIPI-1; WIPI-1 alpha; WIPI49
Common Name WIPI1
Gene Symbol WIPI1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.