Invitrogen™ Human WIPF2 (aa 151-228) Control Fragment Recombinant Protein

Product Code. 30212118

Brand: Invitrogen™ RP93449

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54948 (PA5-54948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Specifications

• Accession Number: Q8TF74
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 147179
• Name: Human WIPF2 (aa 151-228) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110014J05Rik; 5730509C05Rik; AA407487; Gm1176; PP10631; RGD1561080; WAS/WASL interacting protein family member 2; WAS/WASL interacting protein family, member 2; WAS/WASL-interacting protein family member 2; WASP-binding protein; WASP-interacting protein-related protein; WICH; WIP- and CR16-homologous protein; WIPF2; WIP-related protein; Wire
• Common Name: WIPF2
• Gene Symbol: Wipf2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MQRPSLPDLSRPNTTSSTGMKHSSSAPPPPPPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining