Invitrogen™ Human WIPF1 (aa 381-496) Control Fragment Recombinant Protein

Product Code. 30196238

Brand: Invitrogen™ RP102120

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51995 (PA5-51995. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene.

Specifications

• Accession Number: O43516
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7456
• Name: Human WIPF1 (aa 381-496) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI115543; D2Ertd120e; MGC111041; Protein PRPL-2; PRPL-2; testicular tissue protein Li 226; WAS/WASL interacting protein family member 1; WAS/WASL interacting protein family, member 1; WAS/WASL-interacting protein family member 1; WAS2; WASP interacting protein; WASP-interacting protein; WASPIP; Wip; Wipf1; Wiskott-Aldrich syndrome protein interacting protein; wiskott-Aldrich syndrome protein-interacting protein
• Common Name: WIPF1
• Gene Symbol: WIPF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining