Invitrogen™ Human WDTC1 (aa 164-267) Control Fragment Recombinant Protein

Product Code. 30212521

Brand: Invitrogen™ RP94262

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55789 (PA5-55789. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q8N5D0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23038
• Name: Human WDTC1 (aa 164-267) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adipose; adipose homolog; ADP; DCAF9; DDB1 and CUL4 associated factor 9; Gm695; KIAA1037; WD and tetratricopeptide repeats 1; WD and tetratricopeptide repeats protein 1; Wdtc1
• Common Name: WDTC1
• Gene Symbol: WDTC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRENSKHSEVLIDLTEYCGQLVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMKQSPSAGVHTFCDRQKPLPDGAAQYYVAGHLPVKLPDYNNRLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining