Invitrogen™ Human WDR92 (aa 44-133) Control Fragment Recombinant Protein

Product Code. 30206181

Brand: Invitrogen™ RP96033

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57236 (PA5-57236. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WD40 repeats are a common structural module in eukaryotic proteins, and proteins containing WD40 domains have a wide range of functions, including signal transduction, cell cycle regulation, RNA splicing, and transcription. One such protein, WDR92, also known as monad, contains two WD40 repeats is widely expressed in human tissues, especially testis. Overexpression of this protein or its binding partner RNA polymerase II-associated protein 3 (RPAP3) potentiated apoptosis and caspase-3 activation induced by TNF-a and cycloheximide, suggesting that WDR92, together with RPAP3, may function as a novel modulator of apoptosis.

Specifications

• Accession Number: Q96MX6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116143
• Name: Human WDR92 (aa 44-133) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI553587; HZGJ; monad; RGD1563863; testicular secretory protein Li 67; WD repeat domain 92; WD repeat-containing protein 92; WD repeat-containing protein Monad; Wdr92
• Common Name: WDR92
• Gene Symbol: WDR92
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVIQLYEIQHGDLKLLREIEKAKPIKCGTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining