Invitrogen™ Human WDR82 (aa 234-313) Control Fragment Recombinant Protein

Product Code. 30206928

Brand: Invitrogen™ RP104719

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83499 (PA5-83499. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WDR82 is a component of the mammalian SET1A (MIM 611052)/SET1B (MIM 611055) histone H3-Lys4 methyltransferase complexes.

Specifications

• Accession Number: Q6UXN9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80335
• Name: Human WDR82 (aa 234-313) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9430077D24Rik; Cdw5; CDW5/WDR82; MST107; MSTP107; PRO2730; PRO34047; Protein TMEM113; Protein word of mouth; PTK9L; Swd2; TMEM113; transmembrane protein 113; UNQ9342/PRO34047; WD repeat domain 82; WD repeat domain containing 82; WD repeat-containing protein 82; Wdr82; wdr82 protein; WDR82A; wom; word of mouth; wu:fb22h06; zgc:55453; zgc:85635; zgc:91817
• Common Name: WDR82
• Gene Symbol: WDR82
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining