Invitrogen™ Human WDR48 (aa 362-450) Control Fragment Recombinant Protein

Product Code. 30197913

Brand: Invitrogen™ RP96314

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58385 (PA5-58385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WD-repeats are motifs that are found in a variety of proteins and are characterized by a conserved core of 40-60 amino acids, which commonly form a tertiary propeller structure. While proteins that contain WD-repeats participate in a wide range of cellular functions, they are generally involved in regulatory mechanisms involving signal transduction, apoptosis, transcriptional regulation and cell cycle control. WD repeats serve as sites for protein-protein interaction and some seem to mediate the assembly of protein complexes. With eight WD repeats, WDR48 (WD repeat-containing protein 48), also known as USP1-associated factor 1 and p80, is a 677 amino acid protein that functions to regulate deubiquitinating complexes via activation of USP1, USP12 and USP46. WDR48 enhances deubiquitination by increasing catalytic turnover without increasing the affinity of deubiquitinating enzymes for the substrate. WDR48 is ubiquitously expressed and is mainly localized to the cytoplasm. There are five isoforms of WDR48 that are expressed as a result of alternative splicing events.

Specifications

• Accession Number: Q8TAF3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57599
• Name: Human WDR48 (aa 362-450) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430408H12Rik; KIAA1449; mKIAA1449; P80; RGD1309702; SPG60; testicular tissue protein Li 224; Uaf1; USP1 associated factor 1; USP1-associated factor 1; WD repeat domain 48; WD repeat endosomal protein; WD repeat-containing protein 48; WDR48
• Common Name: WDR48
• Gene Symbol: WDR48
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining