Invitrogen™ Human WDR4 Control Fragment Recombinant Protein

Product Code. 30211349

Brand: Invitrogen™ RP91778

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53600 (PA5-53600. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for 7-methylguanosine modification of tRNA. This protein is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD). which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes. including cell cycle progression. signal transduction. apoptosis. and gene regulation. This protein is excluded as a candidate for a form of nonsyndromic deafness (DFNB10). but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternative splicing of this gene generates at least 3 transcript variants. two of which diverge at the 3' UTR and thus encode the same protein products.

Specifications

• Accession Number: P57081
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10785
• Name: Human WDR4 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI415180; AI448349; D530049K22Rik; hWH; mWH; Protein Wuho homolog; TRM82; TRM82 tRNA methyltransferase 82 homolog; TRMT82; tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4; tRNA (guanine-N(7)-)-methyltransferase subunit WDR4; WD repeat domain 4; WD repeat-containing protein 4; WD40 repeat protein 4; WDR4
• Common Name: WDR4
• Gene Symbol: WDR4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSNSGSYFALTDDSKRLILFRTKPWQCLSVRTVAR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining